Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP2 Antibody / UNC18-2

Syntaxin-binding protein 2, also known as UNC18B and UNC18-2, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunofluorescence (FFPE) : 2-4 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

Q15833

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the STXBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This STXBP2 antibody is available for research use only.

Storage Conditions

After reconstitution, the STXBP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the STXBP2 antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE human SK-OC-3 cells with STXBP2 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F12720-01 100 µg

AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F12720-02 1 mg

AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F12720-03 5 mg

AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F12720-04 25 mg

AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F12720-05 50 mg

AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]
E-AB-F12720-06 100 mg

AF/LE Purified Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details