Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTP4A2 Antibody

Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

Q12974

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PTP4A2 antibody is available for research use only.

Storage Conditions

After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PTP4A2 antibody should be determined by the researcher.

Location

Cytoplasmic, membrane

Image Legend

IHC testing of FFPE human prostate cancer with PTP4A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL-6 Monoclonal Antibody
MBS668194-01 0.025 mg

BCL-6 Monoclonal Antibody

Sign In for Pricing
View Details
BCL-6 Monoclonal Antibody
MBS668194-02 0.1 mg

BCL-6 Monoclonal Antibody

Sign In for Pricing
View Details
BCL-6 Monoclonal Antibody
MBS668194-03 5x 0.1 mg

BCL-6 Monoclonal Antibody

Sign In for Pricing
View Details
P27Kip1 (Phospho-Thr187) Polyclonal Conjugated Antibody
orb1631007 100 µL

P27Kip1 (Phospho-Thr187) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TMSL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV814319 1.0 µg DNA

TMSL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Tas1r3 3'UTR GFP Stable Cell Line
TU271582 1.0 mL

Tas1r3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details