Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTP4A2 Antibody

Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

Q12974

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PTP4A2 antibody is available for research use only.

Storage Conditions

After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PTP4A2 antibody should be determined by the researcher.

Location

Cytoplasmic, membrane

Image Legend

IHC testing of FFPE human prostate cancer with PTP4A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHI3L1 Rabbit Polyclonal Antibody (Cy3)
orb2614890 100 µg

CHI3L1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Anti-Human ZNF133 Polyclonal Antibody
HD090014-01 50 µg

Anti-Human ZNF133 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human ZNF133 Polyclonal Antibody
HD090014-02 100 µg

Anti-Human ZNF133 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD274/PD-L1/B7-H1 Protein, C-His
EMJ70101 100 μg

Recombinant Mouse CD274/PD-L1/B7-H1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human Sperm Antigen With Calponin Homology And Coiled-Coil 1
MBS145607-01 0.002 mg

Recombinant Human Sperm Antigen With Calponin Homology And Coiled-Coil 1

Sign In for Pricing
View Details
Recombinant Human Sperm Antigen With Calponin Homology And Coiled-Coil 1
MBS145607-02 0.01 mg

Recombinant Human Sperm Antigen With Calponin Homology And Coiled-Coil 1

Sign In for Pricing
View Details