Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMRP Antibody / FMR1

FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1) . Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL

UniProt

Q06787

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the FMRP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FMRP antibody is available for research use only.

Storage Conditions

After reconstitution, the FMRP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FMRP antibody should be determined by the researcher.

Image Legend

IHC staining of FFPE human testicular seminoma tissue with FMRP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Lambda Light Chain,  30nm
GM-103-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Lambda Light Chain, 30nm

Sign In for Pricing
View Details
Capn8 Mouse Gene Knockout Kit (CRISPR)
KN502513 1 Kit

Capn8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Artery: carotid
CB522066 1 Block

Frozen Tissue Blocks, Artery: carotid

Sign In for Pricing
View Details
Hoechst 34580 *20 mM solution in water*
17538-AAT 100 µL

Hoechst 34580 *20 mM solution in water*

Sign In for Pricing
View Details
BTBD6 Rabbit Polyclonal Antibody
TA372116 100 µL

BTBD6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Viva 2-Steps RT-PCR Kit with M-MULV RT / Chromo Taq DNA Polymerase, 100app
RTPL16 100 Apps

Viva 2-Steps RT-PCR Kit with M-MULV RT / Chromo Taq DNA Polymerase, 100app

Sign In for Pricing
View Details