Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICA1 Antibody / Islet cell autoantigen 1

Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q05084

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the ICA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ICA1 antibody is available for research use only.

Storage Conditions

After reconstitution, the ICA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ICA1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human SH-SY5Y, 2) human RT4, 3) human MCF7, 4) human K562, 5) rat pancreas, 6) rat brain, 7) mouse pancreas and 8) mouse brain tissue lysate with ICA1 antibody. Predicted molecular weight ~55 kDa but can also be observed at 64-69 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin (MYL4) (NM_001002841) Human Over-expression Lysate
LC425089 20 µg

Myosin (MYL4) (NM_001002841) Human Over-expression Lysate

Sign In for Pricing
View Details
Myl4 (NM_010858) Mouse Tagged ORF Clone
MG201865 10 µg

Myl4 (NM_010858) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), Biotin conjugate, 0.1mg/mL
BNCB2419-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Disp1 activation kit by CRISPRa
GA207971 1 Kit

Mouse Disp1 activation kit by CRISPRa

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), 0.2mg/mL
BNUB1897-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), 0.2mg/mL

Sign In for Pricing
View Details
RIC8 (RIC8A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]
TA501055BM 100 µL

RIC8 (RIC8A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details