Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAP1 Antibody / ABCB2

Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

UniProt

Q03518

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the TAP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TAP1 antibody is available for research use only.

Storage Conditions

After reconstitution, the TAP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TAP1 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of human 1) HeLa, 2) HUT and 3) SW620 cell lysate with TAP1 antibody. Expected/observed molecular weight ~87 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

uBE2E1, 1-193aa, Human, His tag, E Coli
MBS204527-01 0.02 mg

uBE2E1, 1-193aa, Human, His tag, E Coli

Sign In for Pricing
View Details
uBE2E1, 1-193aa, Human, His tag, E Coli
MBS204527-02 0.1 mg

uBE2E1, 1-193aa, Human, His tag, E Coli

Sign In for Pricing
View Details
uBE2E1, 1-193aa, Human, His tag, E Coli
MBS204527-03 5x 0.02 mg

uBE2E1, 1-193aa, Human, His tag, E Coli

Sign In for Pricing
View Details
uBE2E1, 1-193aa, Human, His tag, E Coli
MBS204527-04 0.5 mg

uBE2E1, 1-193aa, Human, His tag, E Coli

Sign In for Pricing
View Details
uBE2E1, 1-193aa, Human, His tag, E Coli
MBS204527-05 5x 0.1 mg

uBE2E1, 1-193aa, Human, His tag, E Coli

Sign In for Pricing
View Details
uBE2E1, 1-193aa, Human, His tag, E Coli
MBS204527-06 5x 0.5 mg

uBE2E1, 1-193aa, Human, His tag, E Coli

Sign In for Pricing
View Details