Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP2 Antibody

Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q02086

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ of human SP2 were used as the immunogen for the SP2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the SP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SP2 antibody is available for research use only.

Storage Conditions

After reconstitution, the SP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SP2 antibody should be determined by the researcher.

Location

Nuclear

Image Legend

Western blot testing of 1) rat lung, 2) human A549 and 3) HeLa lysate with SP2 antibody. Expected/observed molecular weight ~72 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX56 (Probable ATP-dependent RNA Helicase DDX56, ATP-dependent 61kD Nucleolar RNA Helicase, DEAD Box Protein 21, DEAD Box Protein 56, DDX21, NOH61) (MaxLight 550)
125744-ML550 100 µL

DDX56 (Probable ATP-dependent RNA Helicase DDX56, ATP-dependent 61kD Nucleolar RNA Helicase, DEAD Box Protein 21, DEAD Box Protein 56, DDX21, NOH61) (MaxLight 550)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human FDFT1 (Farnesyl-diphosphate farnesyltransferase 1) Expressed in vitro E.coli expression system, Full Length
MPX1813K Each

Magic™ Membrane Protein Human FDFT1 (Farnesyl-diphosphate farnesyltransferase 1) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
STAM2 Antibody
E309267 200 µL

STAM2 Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Bromodomain Containing Protein 2 (BRD2)
TRV-0058931-01 20 µL

Polyclonal Antibody to Bromodomain Containing Protein 2 (BRD2)

Sign In for Pricing
View Details
Polyclonal Antibody to Bromodomain Containing Protein 2 (BRD2)
TRV-0058931-02 100 µL

Polyclonal Antibody to Bromodomain Containing Protein 2 (BRD2)

Sign In for Pricing
View Details
Polyclonal Antibody to Bromodomain Containing Protein 2 (BRD2)
TRV-0058931-03 200 µL

Polyclonal Antibody to Bromodomain Containing Protein 2 (BRD2)

Sign In for Pricing
View Details