Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMO1 Antibody / Flavin-containing monooxygenase 1

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q01740

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids AFPFLDESVVKVEDGQASLYKYIFPAHLQK of human FMO1 were used as the immunogen for the FMO1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the FMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FMO1 antibody is available for research use only.

Storage Conditions

After reconstitution, the FMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FMO1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human HCCT, 2) human HepG2, 3) human HUH7, 4) rat liver and 5) mouse liver tissue lysate with FMO1 antibody. Predicted molecular weight ~60 kDa.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)
MBS6497419-01 0.1 mL

RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)

Ask
View Details
RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)
MBS6497419-02 5x 0.1 mL

RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)

Ask
View Details
Frozen Tissue Sections, Ovary: right
CS631073 5x 5 µm

Frozen Tissue Sections, Ovary: right

Ask
View Details
Ctsg Mouse shRNA Plasmid (Locus ID 13035)
TL500459 1 Kit

Ctsg Mouse shRNA Plasmid (Locus ID 13035)

Ask
View Details
Lentiviral human CTDSP1 sgRNA gene knockout kit - Lentiviral human CTDSP1 sgRNA gene knockout kit (100)
GTR15398869 1 Vial

Lentiviral human CTDSP1 sgRNA gene knockout kit - Lentiviral human CTDSP1 sgRNA gene knockout kit (100)

Ask
View Details
RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (HRP)
MBS6180172-01 0.1 mL

RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (HRP)

Ask
View Details