Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11A Antibody

Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

P62491

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ of human RAB11A were used as the immunogen for the RAB11 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the RAB11 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This RAB11 antibody is available for research use only.

Storage Conditions

After reconstitution, the RAB11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the RAB11 antibody should be determined by the researcher.

Image Legend

IF/ICC staining of FFPE human U-2 OS cells with RAB11 antibody (green) at 5ug/ml and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS24 Protein Vector (Human) (pPM-C-HA)
PV026751 500 ng

MRPS24 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MLH1, ID (MLH1, COCA2, DNA mismatch repair protein Mlh1, MutL protein homolog 1) (MaxLight 550)
MBS6321093-01 0.1 mL

MLH1, ID (MLH1, COCA2, DNA mismatch repair protein Mlh1, MutL protein homolog 1) (MaxLight 550)

Sign In for Pricing
View Details
MLH1, ID (MLH1, COCA2, DNA mismatch repair protein Mlh1, MutL protein homolog 1) (MaxLight 550)
MBS6321093-02 5x 0.1 mL

MLH1, ID (MLH1, COCA2, DNA mismatch repair protein Mlh1, MutL protein homolog 1) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human NKX2-1 shRNA (UAS) - Lentiviral human NKX2-1 shRNA (UAS, RFP) (100)
GTR15318567 1 Vial

Lentiviral human NKX2-1 shRNA (UAS) - Lentiviral human NKX2-1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PE anti-mouse CD49e
MBS9472349-01 25 Tests

PE anti-mouse CD49e

Sign In for Pricing
View Details
PE anti-mouse CD49e
MBS9472349-02 100 Tests

PE anti-mouse CD49e

Sign In for Pricing
View Details