Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA2 Antibody

HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL, Immunofluorescence/Immunocytochemistry: 2-4 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

P54652

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK of human HSPA2 were used as the immunogen for the HSPA2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS, IF/ICC

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the HSPA2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This HSPA2 antibody is available for research use only.

Storage Conditions

After reconstitution, the HSPA2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the HSPA2 antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

Western blot testing of 1) rat liver, 2) rat thymus, 3) rat testis, 4) mouse liver, 5) mouse kidney, 6) human HeLa, 7) human MCF7 and 8) human A375 and 9) mouse NIH3T3 lysate with HSPA2 antibody. Expected/observed molecular weight ~70 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurogenin 1 Antibody
orb1325545 100 µL

Neurogenin 1 Antibody

Sign In for Pricing
View Details
NCAPG (non-SMC Condensin I Complex, Subunit G, CAPG, CHCG, FLJ12450, HCAP-G, MGC126525, NY-MEL-3) (HRP)
249159-HRP 100 µL

NCAPG (non-SMC Condensin I Complex, Subunit G, CAPG, CHCG, FLJ12450, HCAP-G, MGC126525, NY-MEL-3) (HRP)

Sign In for Pricing
View Details
Anti-Phospho-Retinoblastoma (S780) RB1 Rabbit Monoclonal Antibody, Carrier-free
M00039-1-carrier-free 100 µL

Anti-Phospho-Retinoblastoma (S780) RB1 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
TNFAIP8L2 Protein Vector (Mouse) (pPM-C-His)
PV240257 500 ng

TNFAIP8L2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
C1orf145 3'UTR Luciferase Stable Cell Line
TU002088 1.0 mL

C1orf145 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Methyl cis-6-Octadecenoate
orb2939580-01 250 mg

Methyl cis-6-Octadecenoate

Sign In for Pricing
View Details