Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMK Antibody / LIM Kinase 1

LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, ELISA: 0.1-0.5 µg/mL

UniProt

P53667

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR of human LIMK1 were used as the immunogen for the LIMK antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the LIMK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This LIMK antibody is available for research use only.

Storage Conditions

After reconstitution, the LIMK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the LIMK antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) mouse stomach, human 3) HeLa, 4) U87 and 5) SKOV lysate with LIMK antibody. Expeccted/observed molecular weight ~72 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SARS-CoV-2 Envelope Antibody [DyLight 405]
NBP3-07060V 0.1 mL

Rabbit Polyclonal SARS-CoV-2 Envelope Antibody [DyLight 405]

Sign In for Pricing
View Details
Mouse Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit
orb781156-01 48 Tests

Mouse Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit
orb781156-02 96 Tests

Mouse Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit

Sign In for Pricing
View Details
2,6-dichloro-N'-[ (cyclopropylcarbonyl) oxy]pyridine-4-carboximidamide
OR27175 1 Each

2,6-dichloro-N'-[ (cyclopropylcarbonyl) oxy]pyridine-4-carboximidamide

Sign In for Pricing
View Details
Rabbit Polyclonal DRG1 Antibody
NBP2-92437-0.1mL 0.1 mL

Rabbit Polyclonal DRG1 Antibody

Sign In for Pricing
View Details
TTPA (Tocopherol (alpha) transfer Protein, ATTP, AVED, TTP1, alphaTTP)
253118 200 µL

TTPA (Tocopherol (alpha) transfer Protein, ATTP, AVED, TTP1, alphaTTP)

Sign In for Pricing
View Details