Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1A1 Antibody

Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37) . It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

UniProt

P48729

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ of human CSNK1A1 were used as the immunogen for the CSNK1A1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the CSNK1A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This CSNK1A1 antibody is available for research use only.

Storage Conditions

After reconstitution, the CSNK1A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the CSNK1A1 antibody should be determined by the researcher.

Location

Nuclear (CK1alphaL variant), Cytoplasmic (CK1alpha variant)

Image Legend

Western blot testing of 1) rat brain, 2) rat kidney, 3) mouse kidney and 4) human HeLa lysate with CSNK1A1 antibody. Expected/observed molecular weight ~39 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Chicken Calprotectin (S100A8/S100A9 Heterodimer) ELISA
KLC0713 1x 96 Well

GENLISA Chicken Calprotectin (S100A8/S100A9 Heterodimer) ELISA

Sign In for Pricing
View Details
Anti-GCLM Rabbit Monoclonal Antibody
M02948-3-200μl 200 µL

Anti-GCLM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HIST1H4H (Histone Cluster 1, H4h, H4/h, H4FH) (MaxLight 405) discontinued
127878-ML405 100 µL

HIST1H4H (Histone Cluster 1, H4h, H4/h, H4FH) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RAB39B (Ras-related Protein Rab-39B, MRX72) (Biotin)
132201-Biotin 100 µL

RAB39B (Ras-related Protein Rab-39B, MRX72) (Biotin)

Sign In for Pricing
View Details
5- (3-Methoxyphenyl) -2-methylfuran-3-carboxylic acid
VZB74023-01 50 mg

5- (3-Methoxyphenyl) -2-methylfuran-3-carboxylic acid

Sign In for Pricing
View Details
5- (3-Methoxyphenyl) -2-methylfuran-3-carboxylic acid
VZB74023-02 0.5 g

5- (3-Methoxyphenyl) -2-methylfuran-3-carboxylic acid

Sign In for Pricing
View Details