Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP1 Antibody

IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, ELISA: 0.1-0.5 µg/mL (mouse protein tested) ; request BSA-free format for coating

UniProt

P47876

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, ELISA (protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the IGFBP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This IGFBP1 antibody is available for research use only.

Storage Conditions

After reconstitution, the IGFBP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the IGFBP1 antibody should be determined by the researcher.

Location

Cytoplasmic, secreted

Image Legend

Western blot testing of 1) rat kidney and 2) mouse kidney lysate with IGFBP1 antibody. Expected molecular weight: 28-35 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C17orf67 shRNA (UAS) - Lentiviral human C17orf67 shRNA (UAS, iRFP) plasmid
GTR15087832 1 Vial

Lentiviral human C17orf67 shRNA (UAS) - Lentiviral human C17orf67 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral human ARHGAP19 shRNA (UAS) - Lentiviral human ARHGAP19 shRNA (UAS, iRFP) plasmid
GTR15152464 1 Vial

Lentiviral human ARHGAP19 shRNA (UAS) - Lentiviral human ARHGAP19 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
J Young Norell Select Series NMR Tube With 5mm NMR Valve 600mhz 7 Long
NMR1280 1 Each

J Young Norell Select Series NMR Tube With 5mm NMR Valve 600mhz 7 Long

Sign In for Pricing
View Details
EMILIN-2 Antibody (Fluoro647)
orb3156942 100 µg

EMILIN-2 Antibody (Fluoro647)

Sign In for Pricing
View Details
Rno-miR-24-3p miRNA Antagomir
CIS0062-01 10 nmol

Rno-miR-24-3p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-24-3p miRNA Antagomir
CIS0062-02 20 nmol

Rno-miR-24-3p miRNA Antagomir

Sign In for Pricing
View Details