Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JNK2 Antibody (alpha/beta)

JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P45984

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids RNYVENRPKYPGIKFEELFPDWIFPSESERDK of human JNK2a/b were used as the immunogen for the JNK2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the JNK2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This JNK2 antibody is available for research use only.

Storage Conditions

After reconstitution, the JNK2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the JNK2 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa and 2) COLO320 cell lysate with JNK2 antibody. Expected/observed molecular weight ~48 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPC2   monoclonal antibody
MB10571 50ul

ARPC2 monoclonal antibody

Sign In for Pricing
View Details
Rig-I Rabbit mAb
C05134-20ul 20 µL

Rig-I Rabbit mAb

Sign In for Pricing
View Details
SLC27A2 Polyclonal Antibody
bs-3936R-01 20 µL

SLC27A2 Polyclonal Antibody

Sign In for Pricing
View Details
SLC27A2 Polyclonal Antibody
bs-3936R-02 100 µL

SLC27A2 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Ankyrin repeat domain containing protein 20A2 (ANKRD20A2) ELISA kit
GTR10423265 96 Well

Rat Ankyrin repeat domain containing protein 20A2 (ANKRD20A2) ELISA kit

Sign In for Pricing
View Details
3- (Aminomethyl) -5-bromopyridin-2-amine
KDC05771-01 50 mg

3- (Aminomethyl) -5-bromopyridin-2-amine

Sign In for Pricing
View Details