Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETV4 Antibody / PEA3

ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P43268

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the ETV4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ETV4 antibody is available for research use only.

Storage Conditions

After reconstitution, the ETV4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ETV4 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat lung, human 2) HeLa, 3) A549 and 4) SW620 lysate with ETV4 antibody. Expected molecular weight: 54-61 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECR Antibody, FITC conjugated
A30943-100UG 100 µg

PECR Antibody, FITC conjugated

Sign In for Pricing
View Details
Rabbit Uncharacterized Protein KIAA0355 (KIAA0355) ELISA Kit
MBS9930090 Inquire

Rabbit Uncharacterized Protein KIAA0355 (KIAA0355) ELISA Kit

Sign In for Pricing
View Details
ZNF345 (Zinc Finger Protein 345, Zinc Finger Protein HZF10) (MaxLight 550)
135698-ML550 100 µL

ZNF345 (Zinc Finger Protein 345, Zinc Finger Protein HZF10) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Polyclonal SFRS18 Antibody
NBP1-88723-25ul 25 µL

Rabbit Polyclonal SFRS18 Antibody

Sign In for Pricing
View Details
Recombinant Human THPO Protein
E30P00370CS 50 µg

Recombinant Human THPO Protein

Sign In for Pricing
View Details
IFN-gamma-Rat LumiAb ELISA Kit
Lum-8204 1 Kit

IFN-gamma-Rat LumiAb ELISA Kit

Sign In for Pricing
View Details