Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT6 Antibody

STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X (L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P42226

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids ESIYQRDPLKLVATFRQILQGEKKAVMEQFR of human STAT6 were used as the immunogen for the STAT6 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the STAT6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This STAT6 antibody is available for research use only.

Storage Conditions

After reconstitution, the STAT6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the STAT6 antibody should be determined by the researcher.

Image Legend

Western blot testing of rat brain with STAT6 antibody. Predicted/observed molecular weight ~94 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp827 shRNA (UAS) - Lentiviral mouse Zfp827 shRNA (UAS, iRFP) plasmid
GTR15269548 1 Vial

Lentiviral mouse Zfp827 shRNA (UAS) - Lentiviral mouse Zfp827 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human Claudin 11 (CLDN11) ELISA Kit
RDR-CLDN11-Hu-48Tests 48 Tests

Human Claudin 11 (CLDN11) ELISA Kit

Sign In for Pricing
View Details
Anti-Spike RBD Reference Antibody (Imdevimab)
E24CVA008 100 µg

Anti-Spike RBD Reference Antibody (Imdevimab)

Sign In for Pricing
View Details
MAFB Human siRNA Oligo Duplex (Locus ID 9935)
SR306676 1 Kit

MAFB Human siRNA Oligo Duplex (Locus ID 9935)

Sign In for Pricing
View Details
PMS1 (4R8) Mouse Monoclonal antibody
E28PE0330 100 µL

PMS1 (4R8) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Cholesterol (Excipient)
HY-N0322B-01 10 mg

Cholesterol (Excipient)

Sign In for Pricing
View Details