Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin Antibody / LEP

Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, ELISA: 0.1-0.5 µg/mL (mouse protein tested) ; request BSA-free format for coating

UniProt

P41160

Host

Rabbit

Reactivity

Mouse

Immunogen

Amino acids KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH of mouse Leptin were used as the immunogen for the Leptin antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, ELISA (protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Leptin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Leptin antibody is available for research use only.

Storage Conditions

After reconstitution, the Leptin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Leptin antibody should be determined by the researcher.

Image Legend

Western blot testing of mouse NIH3T3 cell lysate with Leptin antibody. Expected/observed molecular weight ~16 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -SKBG-1
HY-153918-01 5 mg

(R) -SKBG-1

Sign In for Pricing
View Details
(R) -SKBG-1
HY-153918-02 10 mg

(R) -SKBG-1

Sign In for Pricing
View Details
(R) -SKBG-1
HY-153918-03 25 mg

(R) -SKBG-1

Sign In for Pricing
View Details
(R) -SKBG-1
HY-153918-04 50 mg

(R) -SKBG-1

Sign In for Pricing
View Details
(R) -SKBG-1
HY-153918-05 100 mg

(R) -SKBG-1

Sign In for Pricing
View Details
Cystatin C/Cst3 Rabbit Polyclonal Antibody (Cy3)
orb2611568 100 µg

Cystatin C/Cst3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details