Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta Receptor II Antibody

TGFBR2 (Transforming growth factor, beta receptor II) is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P37173

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK of human TGFBR2 were used as the immunogen for the TGF beta Receptor II antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the TGF beta Receptor II antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TGF beta Receptor II antibody is available for research use only.

Storage Conditions

After reconstitution, the TGF beta Receptor II antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TGF beta Receptor II antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HepG2 and 2) A549 cell lysate with TGF beta Receptor II antibody. Expected molecular weight ~65 kDa, routinely observed at 65-80 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF21 Mouse Monoclonal Antibody [Clone 3G9]
E45M11180V-2 50 µL

FGF21 Mouse Monoclonal Antibody [Clone 3G9]

Sign In for Pricing
View Details
MYPN Peptide - N-terminal region (AAP60348)
AAP60348-100UG 100 µg

MYPN Peptide - N-terminal region (AAP60348)

Sign In for Pricing
View Details
Anti-GCNT6 Antibody
A18737 100 µL

Anti-GCNT6 Antibody

Sign In for Pricing
View Details
CLK2 discontinued
508153 100 µg

CLK2 discontinued

Sign In for Pricing
View Details
RbAp46 shRNA (m) Lentiviral Particles
sc-37961-V 200 µL

RbAp46 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Pesticide Std Monocrotophos 1000ug/mL in MeCn - 1ML
REPET380 1 mL

Pesticide Std Monocrotophos 1000ug/mL in MeCn - 1ML

Sign In for Pricing
View Details