Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Connexin 45 Antibody

Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P36383

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Connexin 45 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Connexin 45 antibody is available for research use only.

Storage Conditions

After reconstitution, the Connexin 45 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Connexin 45 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat stomach, 2) human HeLa and 3) human PANC lysate with Connexin 45 antibody. Expected/observed molecular weight ~45 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FT (HIST3H3) Rabbit Polyclonal Antibody
TA377069 100 µL

H3FT (HIST3H3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: OTI8F6]
CF804215 100 µg

Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: OTI8F6]

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), 0.2mg/mL
BNUB2083-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), 0.2mg/mL

Sign In for Pricing
View Details
Acetic-2,2,2-d3 Acid
TRC-A167646-50MG 50 mg

Acetic-2,2,2-d3 Acid

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), Biotin conjugate, 0.1mg/mL
BNCB2746-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL
BNC680685-500 1x 500 µL

CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details