Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX5 Antibody

Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P35711

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS of human SOX5 were used as the immunogen for the SOX5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the SOX5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SOX5 antibody is available for research use only.

Storage Conditions

After reconstitution, the SOX5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SOX5 antibody should be determined by the researcher.

Image Legend

Western blot testing of rat 1) liver, 2) testis, 3) brain, and human 4) HeLa and 5) A549 lysate with SOX5 antibody. Predicted/observed molecular weight ~84 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit
MBS9343018-01 48 Well

Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit

Sign In for Pricing
View Details
Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit
MBS9343018-02 96 Well

Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit

Sign In for Pricing
View Details
Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit
MBS9343018-03 5x 96 Well

Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit

Sign In for Pricing
View Details
Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit
MBS9343018-04 10x 96 Well

Dog Hypoxanthine-guanine phosphoribosyltransferase, HPRT1 ELISA Kit

Sign In for Pricing
View Details
TARS2 Rabbit Polyclonal Antibody (FITC)
orb2094351 100 µL

TARS2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Test Tubes, Borosilicate Glass
2067350/9 1 Each

Test Tubes, Borosilicate Glass

Sign In for Pricing
View Details