Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1 beta Antibody / HNF1B

HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5) .

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P35680

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the HNF1 beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This HNF1 beta antibody is available for research use only.

Storage Conditions

After reconstitution, the HNF1 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the HNF1 beta antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat liver, 2) rat kidney, 3) human SW620 lysate with HNF1 beta antibody. Predicted/observed molecular weight ~61 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein AM, 1 mg/mL in Anhydrous DMSO
#80011-2 1x 1 mL

Calcein AM, 1 mg/mL in Anhydrous DMSO

Sign In for Pricing
View Details
PARIS (ZNF746) Human Gene Knockout Kit (CRISPR)
KN209784 1 Kit

PARIS (ZNF746) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SPIN3 activation kit by CRISPRa
GA116196 1 Kit

Human SPIN3 activation kit by CRISPRa

Sign In for Pricing
View Details
Trofosfamide
TRC-T892000-250MG 250 mg

Trofosfamide

Sign In for Pricing
View Details
STK25 Human Gene Knockout Kit (CRISPR)
KN203215RB 1 Kit

STK25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF568 conjugate, 0.1mg/mL
BNC682428-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details