Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mmp-12 Antibody

Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, ELISA: 0.1-0.5 µg/mL (mouse protein tested) ; request BSA-free format for coating

UniProt

P34960

Host

Rabbit

Reactivity

Mouse

Immunogen

Amino acids KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK of mouse Mmp-12 were used as the immunogen for the Mmp-12 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, ELISA (protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Mmp-12 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Mmp-12 antibody is available for research use only.

Storage Conditions

After reconstitution, the Mmp-12 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Mmp-12 antibody should be determined by the researcher.

Image Legend

Western blot testing of mouse HEPA lysate with Mmp-12 antibody. Predicted molecular weight: ~55 kDa (pro form), ~45 kDa and ~22 kDa (active forms) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVA12 Antibody
orb798517 2 mg

PVA12 Antibody

Sign In for Pricing
View Details
Mmu-miR-7232-3p antagomir
HY-RI04001A-01 5 nmol

Mmu-miR-7232-3p antagomir

Sign In for Pricing
View Details
Mmu-miR-7232-3p antagomir
HY-RI04001A-02 20 nmol

Mmu-miR-7232-3p antagomir

Sign In for Pricing
View Details
Uap1l1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3617204 1.0 µg DNA

Uap1l1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Feline Leukemia Virus p27 (FLV p27) (PE)
226938-PE 100 µL

Feline Leukemia Virus p27 (FLV p27) (PE)

Sign In for Pricing
View Details
MKS1 Protein Vector (Mouse) (pPM-C-HA)
30182024 500 ng

MKS1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details