Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM2 Antibody

Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

UniProt

P31350

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the RRM2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This RRM2 antibody is available for research use only.

Storage Conditions

After reconstitution, the RRM2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the RRM2 antibody should be determined by the researcher.

Location

Cytoplasmic, membrane

Image Legend

Western blot testing of 1) rat heart, 2) mouse heart, 3) human A431 and 4) human HeLa lysate with RRM2 antibody. Expected/observed molecular weight: 45~50 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)
MBS2054921-01 0.1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)
MBS2054921-02 0.2 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)
MBS2054921-03 0.5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)
MBS2054921-04 1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)
MBS2054921-05 5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)
MBS2054921-06 5x 5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 97 (CD97)

Sign In for Pricing
View Details