Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA1 Antibody

Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA) -binding protein essential for DNA replication, repair, and recombination. It is composed of 70-kD (RPA1), 32-kD (RPA2), and 14-kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified from bacteria, exhibited ssDNA-binding activity comparable to that of the complete RPA complex. RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, but it could not substitute for the complete complex in SV40 DNA replication in vitro, suggesting an important functional role for the other subunits.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

P27694

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the RPA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This RPA1 antibody is available for research use only.

Storage Conditions

After reconstitution, the RPA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the RPA1 antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE human A549 cells with RPA1 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fas Ligand Protein, Human, Recombinant (His Tag)
MBS8118600-01 0.05 mg

Fas Ligand Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Fas Ligand Protein, Human, Recombinant (His Tag)
MBS8118600-02 1 mg

Fas Ligand Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Fas Ligand Protein, Human, Recombinant (His Tag)
MBS8118600-03 5x 1 mg

Fas Ligand Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
IgA Conjugated Antibody
MBS9451493-01 0.1 mL (Biotin)

IgA Conjugated Antibody

Sign In for Pricing
View Details
IgA Conjugated Antibody
MBS9451493-02 0.1 mL (AF350)

IgA Conjugated Antibody

Sign In for Pricing
View Details
IgA Conjugated Antibody
MBS9451493-03 0.1 mL (AF405)

IgA Conjugated Antibody

Sign In for Pricing
View Details