Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLN Antibody / Phospholamban

Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells. The subsequent activation of the Ca (2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells. It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, with markedly lower expression observed in smooth muscles, while the right atrium also expressed low levels of phospholamban. The structure of the human phospholamban gene closely resembles that reported for chicken, rabbit, rat, and mouse. Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL

UniProt

P26678

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF of human PLN were used as the immunogen for the PLN antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the PLN antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PLN antibody is available for research use only.

Storage Conditions

After reconstitution, the PLN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PLN antibody should be determined by the researcher.

Image Legend

IHC staining of FFPE mouse heart tissue with PLN antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Melanoma-Associated Antigen, clone KBA.62 (Monoclonal) Antibody
orb302200 1 mL

Mouse Melanoma-Associated Antigen, clone KBA.62 (Monoclonal) Antibody

Sign In for Pricing
View Details
Anti-PTPN9 Antibody Picoband®, Carrier-free
A08233-1-carrier-free 100 µg/Vial

Anti-PTPN9 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
His tag Rabbit Polyclonal Antibody
orb10813-01 100 µL

His tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
His tag Rabbit Polyclonal Antibody
orb10813-02 200 µL

His tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
His tag Rabbit Polyclonal Antibody
orb10813-03 500 μL

His tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
His tag Rabbit Polyclonal Antibody
orb10813-04 1 mL

His tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details