Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP5 Antibody

Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in two human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved into inactive fragments.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, ELISA: 0.1-0.5 µg/mL (human protein tested) ; request BSA-free format for coating

UniProt

P24593

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER of human IGFBP5 were used as the immunogen for the IGFBP5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, ELISA (protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the IGFBP5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This IGFBP5 antibody is available for research use only.

Storage Conditions

After reconstitution, the IGFBP5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the IGFBP5 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) U20S and 2) HeLa lysate with IGFBP5 antibody. Expected molecular weight: 30 kDa (intact protein), 19-24 kDa (cleavage fragments), 22 kDa (major fragment) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENTT Polyclonal Antibody, FITC Conjugated
bs-7051R-FITC 100 µL

DENTT Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
KRTAP13-2 siRNA (Human)
orb1851048-01 15 nmol

KRTAP13-2 siRNA (Human)

Sign In for Pricing
View Details
KRTAP13-2 siRNA (Human)
orb1851048-02 30 nmol

KRTAP13-2 siRNA (Human)

Sign In for Pricing
View Details
SERPINB11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43467062 1.0 µg DNA

SERPINB11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ANAPC5 (Anaphase Promoting Complex 5, APC5) (MaxLight 550)
MBS6406450-01 0.1 mL

ANAPC5 (Anaphase Promoting Complex 5, APC5) (MaxLight 550)

Sign In for Pricing
View Details
ANAPC5 (Anaphase Promoting Complex 5, APC5) (MaxLight 550)
MBS6406450-02 5x 0.1 mL

ANAPC5 (Anaphase Promoting Complex 5, APC5) (MaxLight 550)

Sign In for Pricing
View Details