Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUR77 Antibody

Nuclear receptor subfamily 4, group A, member 1, also called NAK1, GFRP1, TR3, NUR77 or NGFIB, is a protein that in humans is encoded by the NR4A1 gene, and a member of the Nur nuclear receptor family of intracellular transcription factors. NR4A1 is involved in cell cycle mediation, inflammation and apoptosis. It plays a key role in mediating inflammatory responses in macrophages. In addition, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells. Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells. Nr4a1 is also induced by lithium, a Wnt1 mimic, and the Nr4a1 promoter is activated by lithium and beta-catenin, a Wnt1 downstream effector. In contrast, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells. Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, stimulates glucose production both in vitro and in vivo, and raises blood glucose levels.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P22736

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD of human NUR77 were used as the immunogen for the NUR77 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the NUR77 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This NUR77 antibody is available for research use only.

Storage Conditions

After reconstitution, the NUR77 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the NUR77 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain, 3) human U87 and 4) human HeLa lysate with NUR77 antibody. Expected/observed molecular weight ~67 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN2C1 Human qPCR Template Standard (NM_006715)
HK204544 1 Kit

MAN2C1 Human qPCR Template Standard (NM_006715)

Sign In for Pricing
View Details
Mouse Anti-Porcine Contactin 2 Monoclonal Antibody
VD8N482 1 Each

Mouse Anti-Porcine Contactin 2 Monoclonal Antibody

Sign In for Pricing
View Details
Alk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
11771116 3x 1.0 µg

Alk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human Putative uncharacterized protein CXorf42, NKAPP1 ELISA KIT
ELI-09927h 96 Tests

Human Putative uncharacterized protein CXorf42, NKAPP1 ELISA KIT

Sign In for Pricing
View Details
FCHO1 (m) : 293T Lysate
sc-120228 100 µg - 200 µL

FCHO1 (m) : 293T Lysate

Sign In for Pricing
View Details
XPC Mouse mAb
E2222828 100 µL

XPC Mouse mAb

Sign In for Pricing
View Details