Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP5 Antibody

Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, FACS: 1-3ug/10^6 cells, ELISA: 0.1-0.5 µg/mL (human protein tested) ; request BSA-free format for coating

UniProt

P22003

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS, ELISA (protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the BMP5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This BMP5 antibody is available for research use only.

Storage Conditions

After reconstitution, the BMP5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the BMP5 antibody should be determined by the researcher.

Location

Cytoplasmic, membrane

Image Legend

Western blot testing of 1) rat liver, 2) mouse liver, 3) human A549 lysate with BMP5 antibody. Expected/observed molecular weight ~51 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor rno-miR-375-5p AAV miRNA Vector
Amr3046200 500 ng

Inhibitor rno-miR-375-5p AAV miRNA Vector

Sign In for Pricing
View Details
Rce1 Mouse Pre-designed siRNA Set A
HY-RS19943 1 Set

Rce1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
ZSCAN2 (NM_181877) Human Tagged ORF Clone
RG218021 10 µg

ZSCAN2 (NM_181877) Human Tagged ORF Clone

Sign In for Pricing
View Details
EBF2 (NM_022659) Human Recombinant Protein
PH34660M5 20 µg

EBF2 (NM_022659) Human Recombinant Protein

Sign In for Pricing
View Details
P130 (F-8) : m-IgGκ BP-HRP Bundle
sc-535167 1 Kit

P130 (F-8) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
KCNK10 Antibody
DF13480-01 100 µL

KCNK10 Antibody

Sign In for Pricing
View Details