Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA3 Antibody / Kv1.3

Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P22001

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the KCNA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This KCNA3 antibody is available for research use only.

Storage Conditions

After reconstitution, the KCNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the KCNA3 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain, human 3) K562, 4) HeLa and 5) 22RV1 lysate with KCNA3 antibody. Expected molecular weight ~64 kDa, observed here at ~55 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD36 activation kit by CRISPRa
GA100670 1 Kit

Human CD36 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 4 (TNFSF4) ELISA Kit
RD-TNFSF4-Hu-01 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily, Member 4 (TNFSF4) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 4 (TNFSF4) ELISA Kit
RD-TNFSF4-Hu-02 48 Tests

Human Tumor Necrosis Factor Ligand Superfamily, Member 4 (TNFSF4) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Retroperitoneal region
CS804665 5x 5 µm

Tissue FFPE Sections, Retroperitoneal region

Sign In for Pricing
View Details
ORAI1 (NM_032790) Human Over-expression Lysate
LC403208 20 µg

ORAI1 (NM_032790) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS632957 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details