Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP3 Antibody

IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, ELISA: 0.1-0.5 µg/mL (human protein tested) ; request BSA-free format for coating

UniProt

P17936

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR of human IGFBP3 were used as the immunogen for the IGFBP3 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, ELISA (protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the IGFBP3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This IGFBP3 antibody is available for research use only.

Storage Conditions

After reconstitution, the IGFBP3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the IGFBP3 antibody should be determined by the researcher.

Location

Secreted

Image Legend

Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) rat PC-12, 5) human U-87 MG, 6) mouse kidney, 7) mouse heart and 8) mouse brain lysate with IGFBP3 antibody. Expected molecular weight: 31-44 kDa depending on level of glycosylation.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF2 Human qPCR Template Standard (NM_021088)
HK210873 1 Kit

ZNF2 Human qPCR Template Standard (NM_021088)

Sign In for Pricing
View Details
Rat IL1RL1 shRNA Plasmid
abx985118-01 150 µg

Rat IL1RL1 shRNA Plasmid

Sign In for Pricing
View Details
Rat IL1RL1 shRNA Plasmid
abx985118-02 300 µg

Rat IL1RL1 shRNA Plasmid

Sign In for Pricing
View Details
TNFRSF4 Mouse Monoclonal Antibody [Clone ID: OTI7H9]
TA812430 100 µL

TNFRSF4 Mouse Monoclonal Antibody [Clone ID: OTI7H9]

Sign In for Pricing
View Details
ATP5S, NT (ATP5S, ATPW, ATP synthase subunit s, mitochondrial, ATP synthase-coupling factor B, Mitochondrial ATP synthase regulatory component factor B) (MaxLight 490) discontinued
032289-ML490 100 µL

ATP5S, NT (ATP5S, ATPW, ATP synthase subunit s, mitochondrial, ATP synthase-coupling factor B, Mitochondrial ATP synthase regulatory component factor B) (MaxLight 490) discontinued

Sign In for Pricing
View Details
GENLISA Adenovirus IgG Antibody (ADV-IgG) ELISA
KBVH005 1x 96 Well

GENLISA Adenovirus IgG Antibody (ADV-IgG) ELISA

Sign In for Pricing
View Details