Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD36 Antibody

CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. It is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

UniProt

P16671

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW of human CD36 were used as the immunogen for the CD36 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the CD36 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This CD36 antibody is available for research use only.

Storage Conditions

After reconstitution, the CD36 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the CD36 antibody should be determined by the researcher.

Location

Cell membrane

Image Legend

Western blot testing of 1) rat liver, 2) rat heart, 3) mouse liver, 4) mouse heart and 5) human SMCC lysate with CD36 antibody. Expected molecular weight: ~53/88 kDa (unmodified/glycosylated) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6030458C11Rik Protein Vector (Mouse) (pPM-C-HA)
PV150104 500 ng

6030458C11Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TIE2/TEK Rabbit Polyclonal Antibody (APC)
orb2609851 100 µg

TIE2/TEK Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Anti-Serum Amyloid P/APCS Antibody Picoband® (APC Conjugate)
A00162-APC 100 µg/Vial

Anti-Serum Amyloid P/APCS Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
SEC11C, Recombinant, Human, aa49-192, His-SUMO-Tag (Signal Peptidase Complex Catalytic Subunit SEC11C) discontinued
375238-01 10 µg

SEC11C, Recombinant, Human, aa49-192, His-SUMO-Tag (Signal Peptidase Complex Catalytic Subunit SEC11C) discontinued

Sign In for Pricing
View Details
SEC11C, Recombinant, Human, aa49-192, His-SUMO-Tag (Signal Peptidase Complex Catalytic Subunit SEC11C) discontinued
375238-02 50 µg

SEC11C, Recombinant, Human, aa49-192, His-SUMO-Tag (Signal Peptidase Complex Catalytic Subunit SEC11C) discontinued

Sign In for Pricing
View Details
SEC11C, Recombinant, Human, aa49-192, His-SUMO-Tag (Signal Peptidase Complex Catalytic Subunit SEC11C) discontinued
375238-03 100 µg

SEC11C, Recombinant, Human, aa49-192, His-SUMO-Tag (Signal Peptidase Complex Catalytic Subunit SEC11C) discontinued

Sign In for Pricing
View Details