Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFR alpha Antibody / CD140a

PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2 and CD140a, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

UniProt

P16234

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD of human PDGFRA were used as the immunogen for the PDGFR alpha antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the PDGFR alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PDGFR alpha antibody is available for research use only.

Storage Conditions

After reconstitution, the PDGFR alpha antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PDGFR alpha antibody should be determined by the researcher.

Location

Cytoplasmic, membrane

Image Legend

Western blot testing of 1) rat brain, 2) human HeLa, and 3) mouse NIH3T3 lysate with PDGFR alpha antibody. Expected/observed molecular weight: 120~195 kDa, depending on glycosylation level.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CORO1A Protein, N-His
orb2968724-01 50 µg

Recombinant Human CORO1A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CORO1A Protein, N-His
orb2968724-02 100 µg

Recombinant Human CORO1A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CORO1A Protein, N-His
orb2968724-03 1 mg

Recombinant Human CORO1A Protein, N-His

Sign In for Pricing
View Details
(2-Aminopyrimidin-5-yl) methanol
VEA74785-01 1 g

(2-Aminopyrimidin-5-yl) methanol

Sign In for Pricing
View Details
(2-Aminopyrimidin-5-yl) methanol
VEA74785-02 10 g

(2-Aminopyrimidin-5-yl) methanol

Sign In for Pricing
View Details
ZXDC antibody
70R-21424 50 μL

ZXDC antibody

Sign In for Pricing
View Details