Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NQO1 Antibody

This gene is a member of the NAD (P) H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD) . Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P15559

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK of human NQO1 were used as the immunogen for the NQO1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the NQO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This NQO1 antibody is available for research use only.

Storage Conditions

After reconstitution, the NQO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the NQO1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat liver, 2) rat lung, 3) human HeLa, 4) A549, 5) MM231, 6) SW620 and 7) 22RV1 with NQO1 antibody. Predicted/observed molecular weight ~30 kDa.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Interleukin-18 IL18 Antibody Picoband®, APC Conjugate
PA1342-APC 100 µg/Vial

Anti-Interleukin-18 IL18 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
LZIC Lentiviral Activation Particles (h2)
sc-416376-LAC-2 200 µL

LZIC Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Olfr116 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
32629154 3x 1.0 µg DNA

Olfr116 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Cyp11b1 shRNA (UAS) - Lentiviral mouse Cyp11b1 shRNA (UAS) (100)
GTR15222510 1 Vial

Lentiviral mouse Cyp11b1 shRNA (UAS) - Lentiviral mouse Cyp11b1 shRNA (UAS) (100)

Sign In for Pricing
View Details
DVL3 Recombinant Protein
OPCD02823-50UG 50 µg

DVL3 Recombinant Protein

Sign In for Pricing
View Details
Lime1 Antibody
abx432158 200 µL

Lime1 Antibody

Sign In for Pricing
View Details