Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGP 9.5 Antibody

UchL1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UchL1/PGP9.5 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UchL1/PGP9.5 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL, Immunofluorescence: 2-4 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

P09936

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR of human PGP9.5 were used as the immunogen for the PGP 9.5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IF, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the PGP 9.5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PGP 9.5 antibody is available for research use only.

Storage Conditions

After reconstitution, the PGP 9.5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PGP 9.5 antibody should be determined by the researcher.

Location

Cytoplasmic, membranous

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with PGP 9.5 antibody. Expected/observed molecular weight ~25 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)
ARP6221-01 10 µg

Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)

Sign In for Pricing
View Details
Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)
ARP6221-02 50 µg

Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)

Sign In for Pricing
View Details
Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)
ARP6221-03 100 µg

Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)

Sign In for Pricing
View Details
Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)
ARP6221-04 1 mg

Recombinant Human RELA / Transcription factor p65 / NFkB p65 Protein (aa 1-306, GST tag)

Sign In for Pricing
View Details
MAGD4 Polyclonal Antibody
RA33218-01 50 µL

MAGD4 Polyclonal Antibody

Sign In for Pricing
View Details
MAGD4 Polyclonal Antibody
RA33218-02 100 µL

MAGD4 Polyclonal Antibody

Sign In for Pricing
View Details