Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPARC Antibody

SPARC, secreted protein acidic and rich in cysteine , also known as Osteonectin is a protein that in humans is encoded by the SPARC gene. The human SPARC gene is 26.5 kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33. SPARC is a glycoprotein of ~40 kDa. SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine- rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV) . Osteonectin is a glycoprotein in the bone that binds sodium. It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation. Osteonectin also shows affinity for collagen in addition to bone mineral calcium. A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P09486

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI of human SPARC were used as the immunogen for the SPARC antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the SPARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SPARC antibody is available for research use only.

Storage Conditions

After reconstitution, the SPARC antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SPARC antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa, 2) 293 and 3 MCF7 lysate with SPARC antibody. Observed molecular weight: 35~43 kDa, depending on glycosylation level.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMBRA1 Rabbit Polyclonal Antibody (BF488)
orb2426907 100 µL

AMBRA1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
SFRS8 Antibody
MBS8588641-01 0.1 mg

SFRS8 Antibody

Sign In for Pricing
View Details
SFRS8 Antibody
MBS8588641-02 0.1 mL (AF405L)

SFRS8 Antibody

Sign In for Pricing
View Details
SFRS8 Antibody
MBS8588641-03 0.1 mL (AF405S)

SFRS8 Antibody

Sign In for Pricing
View Details
SFRS8 Antibody
MBS8588641-04 0.1 mL (AF610)

SFRS8 Antibody

Sign In for Pricing
View Details
SFRS8 Antibody
MBS8588641-05 0.1 mL (AF635)

SFRS8 Antibody

Sign In for Pricing
View Details