Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Villin Antibody / VIL1

Villin is known as VIL1. This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. In vertebrates, the villin proteins help to support the microfilaments of the microvilli of the brush border. It may play a role in cell plasticity through F-actin severing.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, Immunofluorescence: 2-4 µg/mL

UniProt

P09327

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids EQLVNKPVEELPEGVDPSRKEEHLSIEDFT of human Villin were used as the immunogen for the Villin antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IF

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Villin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Villin antibody is available for research use only.

Storage Conditions

After reconstitution, the Villin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Villin antibody should be determined by the researcher.

Location

Cytoplasm, luminal membrane of GI tract cells

Image Legend

Western blot testing of 1) rat intestine, 2) mouse kidney, 3) human RH35, 4) HepG2 and 5) MCF7 lysate with Villin antibody. Expected/observed molecular weight ~93 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kit with electrode 201T, pH-buffer, Software, PC-link, USB-cable, accessories in a carrying case
EC-26-pH-1 1 Each

Kit with electrode 201T, pH-buffer, Software, PC-link, USB-cable, accessories in a carrying case

Sign In for Pricing
View Details
Methyl 4,5-dimethoxy-2-[ (2,3,3-trichloroallanoyl) amino]benzoate
OR24409 1 Each

Methyl 4,5-dimethoxy-2-[ (2,3,3-trichloroallanoyl) amino]benzoate

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)
MBS1143027-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)
MBS1143027-02 0.02 mg (Yeast)

Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)
MBS1143027-03 0.1 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)
MBS1143027-04 0.1 mg (Yeast)

Recombinant Yersinia pseudotuberculosis serotype IB Multifunctional CCA protein (cca)

Sign In for Pricing
View Details