Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA Antibody / Glutathione S-transferase alpha 1-5

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules) . In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunofluorescence (FFPE) : 1-2 µg/mL

UniProt

P08263

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids MKLVQTRAILNYIASKYNLYGKDIKERALIDMYIE of human GSTA (1-5) were used as the immunogen for the GSTA antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the GSTA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This GSTA antibody is available for research use only.

Storage Conditions

After reconstitution, the GSTA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the GSTA antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE rat liver with GSTA antibody (green) at 1ug/ml and DAPI nuclear stain (blue) . HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details