Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MR Antibody / Mineralocorticoid Receptor

NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL

UniProt

P08235

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein were used as the immunogen for the MR antibody. This sequence is common to isoforms 1, 3 and 4.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the MR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MR antibody is available for research use only.

Storage Conditions

After reconstitution, the MR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MR antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) huma HeLa, 2) human 293T, 3) human LNCaP, 4) human MCF7, 5) rat NRK and 6) mouse NIH 3T3 cell lysate with MR antibody. Expected molecular weight ~107/108/94 kDa (isoforms 1/3/4) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfy1 Mouse Gene Knockout Kit (CRISPR)
KN520065 1 Kit

Zfy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans-2-Pentenoic Acid
TRC-P227445-50G 50 g

trans-2-Pentenoic Acid

Sign In for Pricing
View Details
Recombinant Rat c-KIT/CD117 Protein (His Tag)
PKSR030234 50 µg

Recombinant Rat c-KIT/CD117 Protein (His Tag)

Sign In for Pricing
View Details
RASSF4 (NM_032023) Human Over-expression Lysate
LC403139 20 µg

RASSF4 (NM_032023) Human Over-expression Lysate

Sign In for Pricing
View Details
Dodecane
TRC-D494625-50ML 50 mL

Dodecane

Sign In for Pricing
View Details
FAM107B (NM_001282703) Human Tagged ORF Clone
RG235912 10 µg

FAM107B (NM_001282703) Human Tagged ORF Clone

Sign In for Pricing
View Details