Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP1 Antibody / Specific Protein 1

SP1 (transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism. It belongs to the Sp/KLF family of transcription factors. The protein is 785 amino acids long, with a molecular weight of 81 kDA. By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13. By in situ hybridization, Gaynor et al. (1993) concluded that 12q13.1 is the most probable location of the SP1 gene. Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm. The formation of 7 head segments depends on the function of several genes. Wimmer et al. (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P08047

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids EAICPEGIARLANSGINVMQVADLQSINISGNGF of human SP1 were used as the immunogen for the SP1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the SP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SP1 antibody is available for research use only.

Storage Conditions

After reconstitution, the SP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SP1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human HeLa, 2) human Caco-2, 3) human Jurkat, 4) human COLO-320 and 5) rat testis tissue lysate with SP1 antibody. Expected molecular weight: 81-95 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLITRK3 CRISPR Activation Plasmid (h)
sc-411622-ACT 20 µg

SLITRK3 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Inhibitor hsa-miR-6819-3p AAV miRNA Vector
Amh3231300 500 ng

Inhibitor hsa-miR-6819-3p AAV miRNA Vector

Sign In for Pricing
View Details
P2RY8 Antibody
ABD5137 100 µg

P2RY8 Antibody

Sign In for Pricing
View Details
N-Desmethyl rizatriptan Hydrochloride
CS-O-06135 1 Each

N-Desmethyl rizatriptan Hydrochloride

Sign In for Pricing
View Details
Mouse COL1 (Collagen Type I) ELISA Kit
MBS8801617-01 48 Well

Mouse COL1 (Collagen Type I) ELISA Kit

Sign In for Pricing
View Details
Mouse COL1 (Collagen Type I) ELISA Kit
MBS8801617-02 96 Well

Mouse COL1 (Collagen Type I) ELISA Kit

Sign In for Pricing
View Details