Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP Antibody (liver)

Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

UniProt

P07148

Host

Rabbit

Reactivity

Human, Mouse, Rat, Monkey, Chicken

Immunogen

Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the FABP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FABP antibody is available for research use only.

Storage Conditions

After reconstitution, the FABP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FABP antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

Western blot testing of 1) rat liver, 2) rat intestine, 3) rat RH35, 4) rat PC-12, 5) mouse liver and 6) mouse small intestine tissue lysate with FABP antibody. Predicted molecular weight: ~14 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALOX5 (Arachidonate 5-lipoxygenase, 5-LO, 5-lipoxygenase, LOG5) (MaxLight 490)
MBS6369655-01 0.1 mL

ALOX5 (Arachidonate 5-lipoxygenase, 5-LO, 5-lipoxygenase, LOG5) (MaxLight 490)

Sign In for Pricing
View Details
ALOX5 (Arachidonate 5-lipoxygenase, 5-LO, 5-lipoxygenase, LOG5) (MaxLight 490)
MBS6369655-02 5x 0.1 mL

ALOX5 (Arachidonate 5-lipoxygenase, 5-LO, 5-lipoxygenase, LOG5) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)
MBS1209485-01 0.02 mg (E-Coli)

Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)
MBS1209485-02 0.1 mg (E-Coli)

Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)
MBS1209485-03 0.02 mg (Yeast)

Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)
MBS1209485-04 0.1 mg (Yeast)

Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0386 protein KPN78578_02510 (KPN78578_02510)

Sign In for Pricing
View Details