Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP Antibody (liver)

Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

UniProt

P07148

Host

Rabbit

Reactivity

Human, Mouse, Rat, Monkey, Chicken

Immunogen

Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the FABP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FABP antibody is available for research use only.

Storage Conditions

After reconstitution, the FABP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FABP antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

Western blot testing of 1) rat liver, 2) rat intestine, 3) rat RH35, 4) rat PC-12, 5) mouse liver and 6) mouse small intestine tissue lysate with FABP antibody. Predicted molecular weight: ~14 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human TIGIT Antibody (SAA0153), FITC
MBS1584785-01 50 Tests

Anti-Human TIGIT Antibody (SAA0153), FITC

Sign In for Pricing
View Details
Anti-Human TIGIT Antibody (SAA0153), FITC
MBS1584785-02 100 Tests

Anti-Human TIGIT Antibody (SAA0153), FITC

Sign In for Pricing
View Details
Anti-Human TIGIT Antibody (SAA0153), FITC
MBS1584785-03 5x 100 Tests

Anti-Human TIGIT Antibody (SAA0153), FITC

Sign In for Pricing
View Details
Lentiviral mouse Vars2 shRNA (UAS) - Lentiviral mouse Vars2 shRNA (UAS, iRFP) (25)
GTR15134078 1 Vial

Lentiviral mouse Vars2 shRNA (UAS) - Lentiviral mouse Vars2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Histone H4, Citrullinated, Recombinant, Human, aa1-103, His-Tag
052599 100 µg

Histone H4, Citrullinated, Recombinant, Human, aa1-103, His-Tag

Sign In for Pricing
View Details
IPO4 Rabbit Polyclonal Antibody
MBS9465274-01 0.05 mL

IPO4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details