Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRAS Antibody

GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

UniProt

P01112

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the HRAS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This HRAS antibody is available for research use only.

Storage Conditions

After reconstitution, the HRAS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the HRAS antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain, and 3) mouse HEPA lysate with HRAS antibody. Expected/observed molecular weight ~21 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYorf15B, ID (CYorf15B, Putative gamma-taxilin-like protein CYorf15B, Lipopolysaccaride-specific response 5-like protein) (APC) discontinued
034420-APC 200 µL

CYorf15B, ID (CYorf15B, Putative gamma-taxilin-like protein CYorf15B, Lipopolysaccaride-specific response 5-like protein) (APC) discontinued

Sign In for Pricing
View Details
AN18A rabbit pAb
ES18361-01 50 µL

AN18A rabbit pAb

Sign In for Pricing
View Details
AN18A rabbit pAb
ES18361-02 100 µL

AN18A rabbit pAb

Sign In for Pricing
View Details
CYP1A1 (A-9) Alexa Fluor® 546
sc-393979 AF546 200 µg/mL

CYP1A1 (A-9) Alexa Fluor® 546

Sign In for Pricing
View Details
OAS2, CT (2'-5'-oligoadenylate Synthase 2, (2-5')oligo(A) Synthase 2, 2-5A Synthase 2, p69 OAS/p71 OAS, p69OAS/p71OAS) (APC)
MBS6490882-01 0.2 mL

OAS2, CT (2'-5'-oligoadenylate Synthase 2, (2-5')oligo(A) Synthase 2, 2-5A Synthase 2, p69 OAS/p71 OAS, p69OAS/p71OAS) (APC)

Sign In for Pricing
View Details
OAS2, CT (2'-5'-oligoadenylate Synthase 2, (2-5')oligo(A) Synthase 2, 2-5A Synthase 2, p69 OAS/p71 OAS, p69OAS/p71OAS) (APC)
MBS6490882-02 5x 0.2 mL

OAS2, CT (2'-5'-oligoadenylate Synthase 2, (2-5')oligo(A) Synthase 2, 2-5A Synthase 2, p69 OAS/p71 OAS, p69OAS/p71OAS) (APC)

Sign In for Pricing
View Details