Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC5C Antibody

Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig) -like domains and 2 type I thrombospondin motifs in the extracellular region.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

O95185

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, FACS

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the UNC5C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This UNC5C antibody is available for research use only.

Storage Conditions

After reconstitution, the UNC5C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the UNC5C antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with UNC5C antibody. Predicted molecular weight ~103 kDa, observed here at ~115 kDa.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti Myosin Heavy Chain, Cardiac, Monoclonal Antibody
MBS460458-01 0.1 mg

Mouse anti Myosin Heavy Chain, Cardiac, Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti Myosin Heavy Chain, Cardiac, Monoclonal Antibody
MBS460458-02 5x 0.1 mg

Mouse anti Myosin Heavy Chain, Cardiac, Monoclonal Antibody

Sign In for Pricing
View Details
TEAD2 AAV Vector (Mouse) (CMV)
46466104 1 µg

TEAD2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
TMPRSS2 Rabbit Polyclonal Antibody (Biotin)
orb2083021 100 µL

TMPRSS2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Core Binding Factor Beta Subunit (CBFb)
MBS2094438-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Core Binding Factor Beta Subunit (CBFb)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Core Binding Factor Beta Subunit (CBFb)
MBS2094438-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Core Binding Factor Beta Subunit (CBFb)

Sign In for Pricing
View Details