Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cd46 Antibody

CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein, is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

O88174

Host

Rabbit

Reactivity

Mouse

Immunogen

Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Cd46 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Cd46 antibody is available for research use only.

Storage Conditions

After reconstitution, the Cd46 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Cd46 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) mouse testis and 2) mouse NIH3T3 lysate with Cd46 antibody. Observed molecular weight: 41~70 kDa depending on glycosylation level.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615)
129480 100 µg

MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615)

Sign In for Pricing
View Details
Myoglobin Mouse mAb, IRDye 800CW conjugated
orb2849593 100 µL

Myoglobin Mouse mAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
CRT0105950
BA4227-10 10 mg

CRT0105950

Sign In for Pricing
View Details
Factor IX antibody (HRP)
MBS835577-01 0.1 mg

Factor IX antibody (HRP)

Sign In for Pricing
View Details
Factor IX antibody (HRP)
MBS835577-02 5x 0.1 mg

Factor IX antibody (HRP)

Sign In for Pricing
View Details
Chicken Destrin (DSTN) ELISA Kit
MBS7217949-01 48 Well

Chicken Destrin (DSTN) ELISA Kit

Sign In for Pricing
View Details