Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGAT Antibody

Acyl-CoA: diacylglycerol acyltransferase 1 (DGAT1) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

O75907

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR of human DGAT1 were used as the immunogen for the DGAT antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the DGAT antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This DGAT antibody is available for research use only.

Storage Conditions

After reconstitution, the DGAT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the DGAT antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat kidney and 2) human HeLa lysate with DGAT antibody. Predicted molecular weight: ~57 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSAD Recombinant Protein (Rat)
RP196445 100 µg

CSAD Recombinant Protein (Rat)

Sign In for Pricing
View Details
Anti-CCL3 antibody
STJ29705 100 µl

Anti-CCL3 antibody

Sign In for Pricing
View Details
Lentiviral human GINS3 shRNA (UAS) - Lentiviral human GINS3 shRNA (UAS, GFP) plasmid
GTR15082846 1 Vial

Lentiviral human GINS3 shRNA (UAS) - Lentiviral human GINS3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Myosin Regulatory Light Chain 12B (MYL12B) Antibody
abx376781-01 50 µg

Myosin Regulatory Light Chain 12B (MYL12B) Antibody

Sign In for Pricing
View Details
Myosin Regulatory Light Chain 12B (MYL12B) Antibody
abx376781-02 100 µg

Myosin Regulatory Light Chain 12B (MYL12B) Antibody

Sign In for Pricing
View Details
Anti-Certolizumab Neutralizing Recombinant Antibody (SAA2961)
AF879213-01 50 µg

Anti-Certolizumab Neutralizing Recombinant Antibody (SAA2961)

Sign In for Pricing
View Details