Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDH1 Antibody

Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD (+) as the electron acceptor and the other NADP (+) . Five isocitrate dehydrogenases have been reported: three NAD (+) -dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP (+) -dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP (+) -dependent isozyme is a homodimer. The protein encoded by this gene is the NADP (+) -dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, IHC (Frozen) : 0.5-1 µg/mL, ICC (FFPE) : 1-2 µg/mL

UniProt

O75874

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK of human IDH1 were used as the immunogen for the IDH1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IHC-F, ICC

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the IDH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This IDH1 antibody is available for research use only.

Storage Conditions

After reconstitution, the IDH1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the IDH1 antibody should be determined by the researcher.

Location

Cytoplasmic, nuclear

Image Legend

Western blot testing of 1) rat lung, 2) rat kidney, 3) rat brain, 4) human HeLa, 5) SMMC, 6) A549 and 7) mouse NIH3T3 lysate with IDH1 antibody. Predicted/observed molecular weight ~47 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMIGD2 Antibody (Biotin)
orb51941-01 50 µg

TMIGD2 Antibody (Biotin)

Sign In for Pricing
View Details
TMIGD2 Antibody (Biotin)
orb51941-02 100 µg

TMIGD2 Antibody (Biotin)

Sign In for Pricing
View Details
SUPT7L Peptide - C-terminal region (AAP67319)
AAP67319-100UG 100 µg

SUPT7L Peptide - C-terminal region (AAP67319)

Sign In for Pricing
View Details
PntB Polyclonal Antibody, FITC Conjugated
A54457-050 50 µL

PntB Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Haptoglobin (Hpt)
MBS2107894-01 0.1 mL

APC/Cy7 Linked Polyclonal Antibody to Haptoglobin (Hpt)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Haptoglobin (Hpt)
MBS2107894-02 0.2 mL

APC/Cy7 Linked Polyclonal Antibody to Haptoglobin (Hpt)

Sign In for Pricing
View Details