Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gremlin 1 Antibody

Gremlin, also known as Drm, is a highly conserved 20.7-kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67) . Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

O60565

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Gremlin 1 antibody is available for research use only.

Storage Conditions

After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human A549, 2) rat testis and 3) mouse testis tissue lysate with Gremlin 1 antibody. Expected molecular weight 21~23 kDa.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Human papillomavirus type 16 E2 Polyclonal Antibody
MBS7166559 Inquire

Rabbit anti-Human papillomavirus type 16 E2 Polyclonal Antibody

Ask
View Details
CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (MaxLight 750)
MBS6256670-01 0.1 mL

CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (MaxLight 750)

Ask
View Details
CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (MaxLight 750)
MBS6256670-02 5x 0.1 mL

CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (MaxLight 750)

Ask
View Details
Sheep Polyclonal MDH1 Antibody [Alexa Fluor 647]
NBP1-77780AF647 0.1 mL

Sheep Polyclonal MDH1 Antibody [Alexa Fluor 647]

Ask
View Details
TMEM1 (TRAPPC10) (NM_003274) Human Over-expression Lysate
LS007109-20ug 20 µg

TMEM1 (TRAPPC10) (NM_003274) Human Over-expression Lysate

Ask
View Details
pExpress-1-Fam48a Plasmid
PVT52387 2 µg

pExpress-1-Fam48a Plasmid

Ask
View Details