Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gremlin 1 Antibody

Gremlin, also known as Drm, is a highly conserved 20.7-kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67) . Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

O60565

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Gremlin 1 antibody is available for research use only.

Storage Conditions

After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human A549, 2) rat testis and 3) mouse testis tissue lysate with Gremlin 1 antibody. Expected molecular weight 21~23 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7C Antibody (N-term)
MBS9204358-01 0.08 mL

BCL7C Antibody (N-term)

Sign In for Pricing
View Details
BCL7C Antibody (N-term)
MBS9204358-02 0.4 mL

BCL7C Antibody (N-term)

Sign In for Pricing
View Details
BCL7C Antibody (N-term)
MBS9204358-03 5x 0.4 mL

BCL7C Antibody (N-term)

Sign In for Pricing
View Details
March7 (NM_001012087) Rat Untagged Clone
RN213552 10 µg

March7 (NM_001012087) Rat Untagged Clone

Sign In for Pricing
View Details
Ptgir AAV siRNA Pooled Vector
38098164 1.0 µg

Ptgir AAV siRNA Pooled Vector

Sign In for Pricing
View Details
mmu-miR-293-3p miRNA Mimic
MBS8300716-01 5 nmol

mmu-miR-293-3p miRNA Mimic

Sign In for Pricing
View Details