Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAPK4 Antibody

MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

UniProt

O15264

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the SAPK4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SAPK4 antibody is available for research use only.

Storage Conditions

After reconstitution, the SAPK4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SAPK4 antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

Western blot testing of 1) rat kidney, 2) human HeLa, and 3) human A549 lysate with SAPK4 antibody. Expected/observed molecular weight ~42 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Stimulating Hormone (TSH) (AP)
MBS6126541-01 0.1 mL

Thyroid Stimulating Hormone (TSH) (AP)

Sign In for Pricing
View Details
Thyroid Stimulating Hormone (TSH) (AP)
MBS6126541-02 5x 0.1 mL

Thyroid Stimulating Hormone (TSH) (AP)

Sign In for Pricing
View Details
RHOV ORF Vector (Human) (pORF)
ORF014296 1.0 µg DNA

RHOV ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Small Glutamine Rich Tetratricopeptide Repeat Containing Alpha (SGTA) Protein
abx260585-01 5 µg

Small Glutamine Rich Tetratricopeptide Repeat Containing Alpha (SGTA) Protein

Sign In for Pricing
View Details
Small Glutamine Rich Tetratricopeptide Repeat Containing Alpha (SGTA) Protein
abx260585-02 25 µg

Small Glutamine Rich Tetratricopeptide Repeat Containing Alpha (SGTA) Protein

Sign In for Pricing
View Details
Small Glutamine Rich Tetratricopeptide Repeat Containing Alpha (SGTA) Protein
abx260585-03 1 mg

Small Glutamine Rich Tetratricopeptide Repeat Containing Alpha (SGTA) Protein

Sign In for Pricing
View Details