Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDM4 Antibody / MDMX

Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

UniProt

O15151

Host

Rabbit

Reactivity

Human, Mouse

Immunogen

Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the MDM4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MDM4 antibody is available for research use only.

Storage Conditions

After reconstitution, the MDM4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MDM4 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) mouse testis and 2) human 22RV1 lysate with MDM4 antibody. Predicted molecular weight ~55 kDa but may be observed at higher molecular weights due to phosphorylation.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO1A Polyclonal Antibody, Cy7 Conjugated
bs-9439R-Cy7-01 20 µL

FOXO1A Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
FOXO1A Polyclonal Antibody, Cy7 Conjugated
bs-9439R-Cy7-02 100 µL

FOXO1A Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Gamma-secretase modulator 3 100mg
A15090-100 100 mg

Gamma-secretase modulator 3 100mg

Sign In for Pricing
View Details
UTX Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV814420 1.0 µg DNA

UTX Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Cxcl10 Rat shRNA Plasmid (Locus ID 245920)
TL712996 1 Kit

Cxcl10 Rat shRNA Plasmid (Locus ID 245920)

Sign In for Pricing
View Details
Recombinant Mouse IgA Antibody
R20169-100UG 100 µg

Recombinant Mouse IgA Antibody

Sign In for Pricing
View Details